LBP Antikörper (C-Term)

Produktnummer ABIN634479

Dieser Anti-LBP Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von LBP in WB. Geeignet für Human.

Kurzübersicht für LBP Antikörper (C-Term) (ABIN634479)

Target: LBP (Lipopolysaccharide Binding Protein (LBP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LBP Antikörper

Bindungsspezifität: C-Term

Spezifität: LBP antibody was raised against the C terminal of LBP

Aufreinigung: Affinity purified

Immunogen: LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LBP Blocking Peptide, (ABIN938351), is also available for use as a blocking control in assays to test for specificity of this LBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LBP

Target: LBP (Lipopolysaccharide Binding Protein (LBP))

Andere Bezeichnung: LBP

Hintergrund: LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: TLR Signalweg, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Monocarboxylic Acid Catabolic Process